DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Gsto1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001007603.1 Gene:Gsto1 / 114846 RGDID:70952 Length:241 Species:Rattus norvegicus


Alignment Length:119 Identity:36/119 - (30%)
Similarity:58/119 - (48%) Gaps:17/119 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGKALGLEFNKKIIN-TLKGEQMNPD-FIKINPQHSIPTLVD-NGFTIWESRAILVYLVEKYGK 62
            ||.||.|:  ..:||| .||.:   |: |.:.||...:|.|.: .|..|.||.....||.|.| .
  Rat    40 MVLKAKGI--RHEIININLKNK---PEWFFEKNPFGLVPVLENTQGHLITESVITCEYLDEAY-P 98

  Fly    63 DDALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQE 116
            :..|:|.|..::|.  |::.|::....|:|...:.:|      ..:||:..::|
  Rat    99 EKKLFPDDPYEKAC--QKMTFELFSKVPSLVTSFIRA------KRKEDHPGIKE 144

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 22/59 (37%)
GstA 6..173 CDD:223698 32/114 (28%)
GST_C_Delta_Epsilon 72..188 CDD:198287 9/45 (20%)
Gsto1NP_001007603.1 GST_N_Omega 5..94 CDD:239353 21/58 (36%)
GstA 26..214 CDD:223698 36/119 (30%)