DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gstz1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:172 Identity:49/172 - (28%)
Similarity:88/172 - (51%) Gaps:29/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLK--GEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPK 69
            |:|:::::||.:|  |.|::.::.::||...:|.|..:|.|:.:|.||:.|| |:...:..|.|:
 Frog    29 GIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGVTLSQSLAIIEYL-EETRPNPPLLPR 92

  Fly    70 DIQKQAVINQRLYFD-MALMYPTLANY------------YYKAFTTGQFGSEEDYKKVQETFDFL 121
            |.:|:|.:  |:..| :|.....|.|.            :.|.|.|..|.:.|  |.:|.|    
 Frog    93 DPKKRAQV--RMISDQIASGIQPLQNLCVLQKIGETKLEWAKHFITRGFQALE--KLLQTT---- 149

  Fly   122 NTFLEGQDYVAGDQYTVADIAILANVSNFDVVGFDISKYPNV 163
                .|: |..||:.|:||:.::..|:|......|::.||.:
 Frog   150 ----AGR-YCVGDEVTIADLCLVPQVANAVRFKVDLAPYPTI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 18/52 (35%)
GstA 6..173 CDD:223698 49/172 (28%)
GST_C_Delta_Epsilon 72..188 CDD:198287 27/105 (26%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 49/172 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.