DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and Clic5

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:207 Identity:46/207 - (22%)
Similarity:78/207 - (37%) Gaps:44/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GGC---RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVY 71
            |.|   :.:.|:....|:..|   :.|::.::...:...|.|....|.|..||....:...|..:
  Rat    30 GNCPFSQRLFMILWLKGVVFN---VTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEF 91

  Fly    72 LVEKYGKDDYLLPNDPKKRAVINQRLYFDMG-TLYESFAKYYYPLFRTGKPGSDEDLKR-IETAF 134
            |.|....:.|     ||..|  ..|.....| .::..|:.|    .:..|..::..|:| :..|.
  Rat    92 LEETLTPEKY-----PKLAA--RHRESNTAGIDIFSKFSAY----IKNTKQQNNAALERGLTKAL 145

  Fly   135 GFLDTFL------------EGQE------YVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSR 181
            ..||.:|            .|.|      ::.||:||:||..:|..:...::..   .||.|   
  Rat   146 RKLDDYLNTPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVA---KKYRN--- 204

  Fly   182 WYDNAKKVTPGW 193
             ||...::|..|
  Rat   205 -YDIPAEMTGLW 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 14/66 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/126 (23%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 15/70 (21%)
O-ClC 14..249 CDD:129941 46/207 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.