DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and CAM1

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:47/204 - (23%)
Similarity:85/204 - (41%) Gaps:36/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLV-DNGFSIWESRAI 68
            ::|.|        :.|||.|:: |.:......||...:|    |...:|..| ..|:.:.|:.||
Yeast    15 WVPRG--------LVKALKLDV-KVVTPDAAAEQFARDF----PLKKVPAFVGPKGYKLTEAMAI 66

  Fly    69 AVYLVEKYGKDDYL------LPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDL 127
            ..||| |..:||.:      ..:|...:|.|.:........|....|....||    |.|:..:.
Yeast    67 NYYLV-KL
SQDDKMKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPL----KGGAPYNK 126

  Fly   128 KRIETAFGFLDTF-------LEGQEYVAGDQLTVADIAILSTVSTFEVSEFDF---SKYSNVSRW 182
            |.:::|...:|..       |:...|:|.:.:::||:...|..:.:..|.|..   :::..:.||
Yeast   127 KSVDSAMDAVDKIVDIFENRLKNYTYLATENISLADLVAASIFTRYFESLFGTEWRAQHPAIVRW 191

  Fly   183 YDNAKKVTP 191
            : |..:.:|
Yeast   192 F-NTVRASP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/69 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/114 (20%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 20/71 (28%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 23/113 (20%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345058
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.