DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and URE2

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:187 Identity:52/187 - (27%)
Similarity:81/187 - (43%) Gaps:41/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNG---FSIWESRAIAVYLVEKY 76
            |.:|...||...|...|:...||...||||.:||...:|.|:|:|   .|||||.||.::||.||
Yeast   128 VAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWESGAILLHLVNKY 192

  Fly    77 GKD---DYLLPNDPKKRAVINQRLYFDMGTLYESFAK-YYYPLFRTGKPGS-----DEDLKRI-- 130
            .|:   ..|..:|...::.||..|:|..........: .::..|.:.|..|     .::::|:  
Yeast   193 YKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQKIASAVERYTDEVRRVYG 257

  Fly   131 ----------ETAFGFLDT-----------------FLEGQEYVAGDQLTVADIAIL 160
                      |.....|||                 |.:...::.||:||:||:|.:
Yeast   258 VVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIADLAFV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 26/61 (43%)
GST_C_Delta_Epsilon 88..204 CDD:198287 20/108 (19%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 29/65 (45%)
GST_C_Ure2p 208..350 CDD:198326 20/107 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2827
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.