DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and TEF4

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:45/210 - (21%)
Similarity:78/210 - (37%) Gaps:43/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ELNKKLLNTMEGEQLKPEFVKLNPQHTIPT-LVDNGFSIWESRAIAVYLVEKYGKDDYLLPNDPK 88
            :|:.|:::..:..    ||..|.|....|. |...|..:.|:.||..||..:..        |.|
Yeast    25 KLDVKIVDLEQSS----EFASLFPLKQAPAFLGPKGLKLTEALAIQFYLANQ
VA--------DEK 77

  Fly    89 KRA------VINQRLYFDMGTLYES-----FAKYYYP---LFRTGKPGSDEDLKRIETAFGFLDT 139
            :||      ||.:.......:|..|     .|:.:..   |....|...|....:|:......|.
Yeast    78 ERARLLGSDVIEKSQILRWASLANSDVMSNIARPFLSFKGLIPYNKKDVDACFVKIDNLAAVFDA 142

  Fly   140 FLEGQEYVAGDQLTVADIAILST----VSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDENWEGL 200
            .|....:||.:.:::.|:....:    ::|....|:. :|:.::.||: |....:|         
Yeast   143 RLRDYTFVATENISLGDLHAAGSWAFGLATILGPEWR-AKHPHLMRWF-NTVAASP--------- 196

  Fly   201 MAMKALFDARKLAAK 215
             .:|..|...|||.|
Yeast   197 -IVKTPFAEVKLAEK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 14/49 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/133 (18%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 14/50 (28%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 25/134 (19%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.