DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GTT2

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:171 Identity:45/171 - (26%)
Similarity:74/171 - (43%) Gaps:26/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LNTMEGEQLKPEFVKLNPQHTIPTL-VDNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVI- 93
            :|..:||..||||:..|...|:|.| :|:|..|.|..||..| ::.......|....|.::.|| 
Yeast    51 INLWKGEHKKPEFLAKNYSGTVPVLELDDGTLIAECTAITEY-ID
ALDGTPTLTGKTPLEKGVIH 114

  Fly    94 --NQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDL-----------KRIETAFG--FLDTFLEG 143
              |:|...:   |.:..:.|    |....||...::           :|.:...|  :.||.|..
Yeast   115 MMNKRAELE---LLDPVSVY----FHHATPGLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRE 172

  Fly   144 QEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSR-WY 183
            :.|||||..::|||.:::.:....:.:....:.....| ||
Yeast   173 RPYVAGDSFSMADITVIAGLIFAAIVKLQVPEECEALRAWY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 18/43 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/113 (22%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 18/43 (42%)
GST_C_GTT2_like 106..222 CDD:198291 26/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345133
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.