DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTF14

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:187 Identity:51/187 - (27%)
Similarity:85/187 - (45%) Gaps:19/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GLELNKKLLNTMEGEQLKPEFVK-LNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKD--DYLLP 84
            ||:.....::.:.||.....|:. |||...:|.|.|....::|.:||..||.|:| ||  ..|||
plant    27 GLDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQY-KDVGTNLLP 90

  Fly    85 NDPKKRAVINQRLYFD-------MGTLYESFAKYYYPLFRTGKPGSDEDLKRIETAFGFLDTFLE 142
            :||||||:::..:..|       ..||.:......|....|......|:.:::.......:|.|.
plant    91 DDPKKRAIMSMWMEVDSNQFLPIASTLIKELIINPYQGLATDDTAVQENKEKLSEVLNIYETRLG 155

  Fly   143 GQEYVAGDQLTVADIAILSTVSTF------EVSEFDFSKYSNVSRWYDNAKKVTPGW 193
            ...|:||:..::||:..|:.:...      |:....:|: .||:.|.:. .|:.|.|
plant   156 ESPYLAGESFSLADLHHLAPIDYLLNTDEEELKNLIYSR-PNVAAWVEK-MKMRPAW 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 16/51 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/119 (22%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 16/52 (31%)
GST_C_Phi 94..214 CDD:198296 26/119 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.