DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTF5

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:234 Identity:59/234 - (25%)
Similarity:94/234 - (40%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68
            |..|.....|.|:.|....||..:...:|.:.|:|.||.|:.:||...:|..:|.|..:.|||||
plant    67 YGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRAI 131

  Fly    69 AVYLVEKYGKDDYLLPNDPKKRA--VINQRLYFDMGT-----LYESFAKYYYPLFRT------GK 120
            :.|:...:           |.|.  ::|.:.|..|||     ..|||.  :.||..|      .|
plant   132 SEYIA
TVH-----------KSRGTQLLNYKSYKTMGTQRMWMAIESFE--FDPLTSTLTWEQSIK 183

  Fly   121 P--GSDEDLK-------RIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFD--FS 174
            |  |...|.|       ::|......:..|:...::|.:..|:||:..|..:.....:...  |.
plant   184 PMYGLKTDYKVVNETEAKLEKVLDIYEERLKNSSFLASNSFTMADLYHLPNIQYLMDTHTKRMFV 248

  Fly   175 KYSNVSRWYDNAKKVT--PGWDENWEGLMAMKALFDARK 211
            ...:|.||   ..::|  |.|....:    :||.:..:|
plant   249 NRPSVRRW---VAEITARPAWKRACD----VKAWYHKKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 24/69 (35%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/141 (23%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 24/68 (35%)
GST_C_Phi 153..270 CDD:198296 28/121 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.