DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTF7

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:203 Identity:50/203 - (24%)
Similarity:84/203 - (41%) Gaps:24/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVY 71
            |.....|.|::......|:.....:...:||..|..|:..||...:|...|..|.::|||||..|
plant    10 PASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQY 74

  Fly    72 LVEKYG-KDDYLLPNDPKKRAVINQRL-----YFD-MGT--LYESFAKYYYPLFRTGKPGSDEDL 127
            :...|. |.:.|:....|..|.|...:     .|| :|:  ::|...|..|.: .|.|...:|:.
plant    75 IAH
FYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGM-TTDKTVVEEEE 138

  Fly   128 KRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEV-----SEFDFSKYSNVSRWY---- 183
            .::.......:..|...:|:|.|:.|:.|   |.|:...:.     ::..|.:..:||.|.    
plant   139 AKLAKVLDVYEHRLGESKYLASDKFTLVD---LHTIPVIQYLLGTPTKKLFDERPHVSAWVADIT 200

  Fly   184 --DNAKKV 189
              .:||||
plant   201 SRPSAKKV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/66 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/121 (23%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 19/66 (29%)
GST_C_Phi 95..209 CDD:198296 27/118 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.