DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTF4

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:221 Identity:48/221 - (21%)
Similarity:79/221 - (35%) Gaps:44/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVY 71
            |.....|.|:.|.....|......:....||.....|:.|||...:|...|....::|||||..|
plant    43 PFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQY 107

  Fly    72 LVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTL-------------------YESFAKYYYPLFR 117
            :.       |:  :..:...::|.|.:..|.||                   :|...|..|.| .
plant   108 IA
-------YV--HSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKPIYGL-E 162

  Fly   118 TGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVS------TFEVSEFDFSKY 176
            |.:....|:...:|......:..||...::|.:..|:.|:..|..:.      |.::    |.|.
plant   163 TDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGTPTKKL----FEKR 223

  Fly   177 SNVSRWYD-----NAKKVTPGWDENW 197
            |.|.:|.|     .|.|:....:::|
plant   224 SKVRKWVDEITSREAWKMACDQEKSW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/66 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/140 (20%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 19/65 (29%)
GST_C_Phi 126..243 CDD:198296 25/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.