DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and Clic4

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:170 Identity:40/170 - (23%)
Similarity:67/170 - (39%) Gaps:46/170 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVI 93
            |:...:|.....|:::||:|:|.            ||....:.:..|:..  |:..:.|:....:
  Rat    90 KIEEFLEEVLCPPKYLKLSPKHP------------ESNTAGMDIFAKFSA--YIKNSRPEANEAL 140

  Fly    94 NQRLYFDMGTLYESFAKYYYPLFRTGKPG-----SDEDLKRIETAFGFLDTFLEGQEYVAGDQLT 153
            .:.|   :.||.:.......||     ||     |.||:|  .:...|||          ||::|
  Rat   141 ERGL---LKTLQKLDEYLNSPL-----PGEIDENSMEDIK--SSTRRFLD----------GDEMT 185

  Fly   154 VADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGW 193
            :||..:|..:...:|..   .||.|    :|..|.:|..|
  Rat   186 LADCNLLPKLHIVKVVA---KKYRN----FDIPKGMTGIW 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 9/44 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/111 (25%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 2/10 (20%)
GST_N_CLIC 14..104 CDD:239359 3/13 (23%)
O-ClC 17..252 CDD:129941 40/170 (24%)
GST_C_family 111..251 CDD:295467 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347841
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.