DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTT2

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:220 Identity:59/220 - (26%)
Similarity:103/220 - (46%) Gaps:25/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77
            |.|::..|...::.::.|::..:.:||.|||.::||...:|.:||....::||.||.:||...|.
plant    15 RAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFESHAILIYLSSAYA 79

  Fly    78 K-DDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYY----------YPLFRTGKPGSDEDLKRIE 131
            . .|:..|||..|||.|:..|.:....|....:.|.          .||    .|.:..:.:.|.
plant    80 SVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPL----NPKAAAEAENIL 140

  Fly   132 T-AFGFLDTF-LEGQE--YVAGDQLTVADIAILSTVSTFEVSEFD-----FSKYSNVSRWYDNAK 187
            | :...|:|| |:|..  .:.|.|.::||::::..:...:|.:..     .|.:..|.:|.::.:
plant   141 TNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLRLLSPHKKVEQWIESTR 205

  Fly   188 KVT-PGWDENWEGLMAMKALFDARK 211
            |.| |..||..|.|...|..|..::
plant   206 KATMPHSDEVHEVLFRAKDRFQKQR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 20/60 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/135 (24%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 20/62 (32%)
GST_C_Theta 92..221 CDD:198292 32/132 (24%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.