DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTT3

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:213 Identity:59/213 - (27%)
Similarity:99/213 - (46%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKY- 76
            |.|::..|...::.::.|:.....:||.|||..:||...:|.:||....:.||.||.:||...| 
plant    15 RAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSESHAILIYLSSAYP 79

  Fly    77 GKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYY----------YPLFRTGKPGSDEDLKRIE 131
            ...|:..|.|..|||.|:..|.:....|....|.|.          .||    .|.:..:.:::.
plant    80 SVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPL----NPKAAAEAEQLL 140

  Fly   132 T-AFGFLDTF-LEGQE--YVAGDQLTVADIAILSTVSTFEVSEFD-----FSKYSNVSRWYDNAK 187
            | :...|||| |:|..  .:..:|.::||::::..::..:|.:..     .|.:.||.:|.:|.:
plant   141 TKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLRLLSPHKNVEQWIENTR 205

  Fly   188 KVT-PGWDENWEGLMAMK 204
            |.| |.:||..|.|...|
plant   206 KATMPHFDEVHEVLFRAK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 20/60 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 34/135 (25%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 50/190 (26%)
GST_N_Theta 3..78 CDD:239348 20/62 (32%)
GST_C_Theta 92..221 CDD:198292 34/132 (26%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.