DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTT1

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:220 Identity:63/220 - (28%)
Similarity:109/220 - (49%) Gaps:25/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKY- 76
            |.||:..|..|::.::.|::..:.:||.|||..:||...:|.:||....::||.||.:||...: 
plant    16 RAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKLFESHAILIYLSSAFP 80

  Fly    77 GKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYY----------YPLFRTGKPGSDEDLKRIE 131
            ...|:..|||..|||.|:..|.:....|....|.|.          .||    .|.:..:.:::.
plant    81 SVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALGLPL----NPKAAAEAEQLL 141

  Fly   132 T-AFGFLDTF-LEGQ-EYVAG-DQLTVADIAILSTVSTFEVSEFD-----FSKYSNVSRWYDNAK 187
            | :...|:|| |:|. :::.| :|.::||::::..:...:|.:..     .|.:..|.:|.:|.|
plant   142 TKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLSTHKKVEQWIENTK 206

  Fly   188 KVT-PGWDENWEGLMAMKALFDARK 211
            |.| |.:||..|.|..:|..|..|:
plant   207 KATMPHFDETHEILFKVKEGFQKRR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/60 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 34/135 (25%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 22/62 (35%)
GST_C_Theta 93..223 CDD:198292 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.