DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTF12

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:206 Identity:54/206 - (26%)
Similarity:92/206 - (44%) Gaps:40/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG-KDDYLL 83
            |.:..|:....|:|.  ||.|||.:...|...:|.:.|..|.::||||||.|...|:. :...||
plant    24 KGIEFEIIHIDLDTF--EQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKFADQGTNLL 86

  Fly    84 PNDPKKRAVINQRLYFDMGTLYESFAKYYYPLF-------RTGKPGSD----EDLK-RIETAFGF 136
            ....:.||:::|  :.|:.|.|  |.....||.       |.|:. .|    |||| ::......
plant    87 GKSLEHRAIVDQ--WADVETYY--FNVLAQPLVINLIIKPRLGEK-CDVVLVEDLKVKLGVVLDI 146

  Fly   137 LDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKY----SNVSRWYDNAKKVTPGWDE-- 195
            .:..|....::||::.|:||:..:..:. :.:|..|.::.    .:.:||          |:|  
plant   147 YNNRLSSNRFLAGEEFTMADLTHMPAMG-YLMSITDINQMVKARGSFNRW----------WEEIS 200

  Fly   196 ---NWEGLMAM 203
               :|:.||.:
plant   201 DRPSWKKLMVL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 20/53 (38%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/137 (23%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 54/206 (26%)
GST_N_Phi 2..77 CDD:239351 20/54 (37%)
GST_C_Phi 91..209 CDD:198296 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.