DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTF8

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:212 Identity:57/212 - (26%)
Similarity:96/212 - (45%) Gaps:35/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TVIMVA-KALGLELN---KKLLNTMEGEQLKPEFV---------------KLNPQHTIPTLVDNG 59
            ::||.: |..|:.::   .::|.|:..:.|:.|.:               .|||...||.|.|..
plant    46 SIIMASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGD 110

  Fly    60 FSIWESRAIAVYLVEKYG-KDDYLLPNDPKK-RAVINQRL-----YFDMGTLYESFAKYYYPLF- 116
            .:::|||||..||.|:|. |.:.|:..|.|| :|..|..|     .||......:|.:.:..:| 
plant   111 LTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGMFG 175

  Fly   117 RTGKPGSDEDLK-RIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTF--EVSEFDFSKYSN 178
            .|..|.:.::|: :::......:..|...|::|||..|:||:..|..:...  ..|:..|.....
plant   176 MTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFDSRPK 240

  Fly   179 VSRWYDNAKKVT--PGW 193
            ||.|   .||::  |.|
plant   241 VSEW---IKKISARPAW 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/78 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/118 (25%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.