DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTF10

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:222 Identity:59/222 - (26%)
Similarity:91/222 - (40%) Gaps:52/222 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIA 69
            |.|.....:..::.....|:......::.|:|||.:||::.:.|...||.|||..:.|:|||||.
plant     6 YAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIM 70

  Fly    70 VYLVEKY---GKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFR----------TGKP 121
            .|:.|||   |.|  ||....::|..:.|.|..:.       ..|:.||..          .|.|
plant    71 RYIAEKYRSQGPD--LLGKTIEERGQVEQWLDVEA-------TSYHPPLLALTLNIVFAPLMGFP 126

  Fly   122 GSDEDLKRIETAFG-FLDTF---LEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKY------ 176
            ..::.:|..|.... .||.:   |...||:|||.:::||:|.|           .|::|      
plant   127 ADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHL-----------PFTEYLVGPIG 180

  Fly   177 --------SNVSRWYDNAKKVTPGWDE 195
                    .:||.|:|.... ...|.|
plant   181 KAHLIKDRKHVSAWWDKISS-RAAWKE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/68 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/136 (22%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 59/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.