DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTF9

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:212 Identity:58/212 - (27%)
Similarity:91/212 - (42%) Gaps:54/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKY--- 76
            |.::.|.:..|...  ::.|:||..:|.::.|.|..|:|.:||..:.|:||||:..|:.|||   
plant    18 VTLIEKGVAFETIP--VDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVMRYVAEKYRSQ 80

  Fly    77 GKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFR----------TGKPGSDEDLKRIE 131
            |.|  ||....:.|..:.|.|..:..|       |:.||..          .|.|..::.:|..|
plant    81 GPD--LLGKTVEDRGQVEQWLDVEATT-------YHPPLLNLTLHIMFASVMGFPSDEKLIKESE 136

  Fly   132 TAF-GFLDTF---LEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKY--------------SN 178
            ... |.||.:   |...:|:|||.:::||:|.|           .|:.|              .:
plant   137 EKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHL-----------PFTDYLVGPIGKAYMIKDRKH 190

  Fly   179 VSRWYDNAKKVTPGWDE 195
            ||.|:|:... .|.|.|
plant   191 VSAWWDDISS-RPAWKE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/58 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/136 (24%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 58/212 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.