DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTF3

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:169 Identity:41/169 - (24%)
Similarity:67/169 - (39%) Gaps:25/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVY 71
            |.....|.|::......|:.....:...:||..|..|:..||...:|...|....::|||||..|
plant    10 PASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQY 74

  Fly    72 LVEKY-GKDDYLLPNDPKKRAVINQRLYFDMG--------------TLYESFAKYYYPLFRTGKP 121
            :..:| .:...|||.|.|.   |.|.....:|              ..:|...|:.|.|......
plant    75 IAHRYENQGTNLLPADSKN---IAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNTDQAV 136

  Fly   122 GSDEDLKRIETAFGFLDTF---LEGQEYVAGDQLTVADI 157
            .::|:.|..:.    ||.:   |:..:|:||:..|:.|:
plant   137 VAEEEAKLAKV----LDVYEARLKEFKYLAGETFTLTDL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 18/66 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 18/87 (21%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 41/169 (24%)
GST_N_Phi 4..78 CDD:239351 18/67 (27%)
GST_C_Phi 96..212 CDD:198296 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.