DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GDAP1L1

DIOPT Version :10

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:63 Identity:14/63 - (22%)
Similarity:30/63 - (47%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLV--DNGFSIWE 64
            |:.......:.|.:|....||...::.::..:.|..:|.|::||....:|.::  ||..|.::
Human    50 YHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 14/63 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287
GDAP1L1NP_001243666.1 GST_N_GDAP1 47..119 CDD:239350 14/63 (22%)
GST_C_GDAP1L1 220..330 CDD:198335
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.