Sequence 1: | NP_524912.1 | Gene: | GstD2 / 48335 | FlyBaseID: | FBgn0010038 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080283.3 | Gene: | Eef1g / 67160 | MGIID: | 1914410 | Length: | 437 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 49/196 - (25%) |
---|---|---|---|
Similarity: | 87/196 - (44%) | Gaps: | 43/196 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 PEFVKLNPQHTIPTLV-DNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTL 104
Fly 105 YESFAKYYYPLF------RTGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTV 163
Fly 164 STF--EVSEFDFSK-YSNVSRWY-------------DNAKKVTPGWDENWEGLMAMKALFDARKL 212
Fly 213 A 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD2 | NP_524912.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 14/33 (42%) |
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 27/137 (20%) | ||
Eef1g | NP_080283.3 | GST_N_EF1Bgamma | 4..82 | CDD:239342 | 14/39 (36%) |
GstA | 5..202 | CDD:223698 | 41/162 (25%) | ||
GST_C_EF1Bgamma_like | 91..213 | CDD:198290 | 27/136 (20%) | ||
FinO_conjug_rep | <211..>265 | CDD:301594 | 6/12 (50%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 221..268 | 1/2 (50%) | |||
EF1G | 275..381 | CDD:279041 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |