DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and gstr

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:214 Identity:52/214 - (24%)
Similarity:93/214 - (43%) Gaps:22/214 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNK-KLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWE 64
            |..|:..|...|..:::..:...|:..| |||:..:.|...||...|||:..:||.......:.|
Zfish     5 MLLYWGTGSPPCWRLMIALEEKQLQGYKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGEIVVNE 69

  Fly    65 SRAIAVYLVEKY-GKDDYLLPNDPKKRAVINQRLYFDMGTL----YE-SFAKYYYP-------LF 116
            |.|..:||...: .:...|:|::|.:.|::.||: |:...|    || :|..:..|       ..
Zfish    70 SFAACLYLESVFKSQGTRLIPDNPAEMALVYQRM-FETENLQQKMYEVAFYDWLVPEGERLESAL 133

  Fly   117 RTGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSR 181
            :..|....|:||..|   |:|:...:| .|:||...::||:.....::.|...:....:...:..
Zfish   134 KRNKEKLIEELKLWE---GYLEKMGKG-SYLAGKNFSMADVVCFPVIAYFPRLQCPKERCPRLME 194

  Fly   182 WYDNAK---KVTPGWDENW 197
            :|:..|   .:...|...|
Zfish   195 YYEMVKDRPSIKASWPPEW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/73 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/125 (22%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 50/206 (24%)
GST_N_family 5..78 CDD:238319 21/72 (29%)
GST_C_family 99..199 CDD:198286 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.