DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and gstt1a

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:224 Identity:61/224 - (27%)
Similarity:106/224 - (47%) Gaps:28/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            :|.:..|    ||:|.:.||...:....|.::...|||...||.|::....:|.|.|..|.:.||
Zfish     7 LDLHSQP----CRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTES 67

  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFR------TGKPGSD 124
            .||.:||..|:...|:..|.|.:|||.:::.|.:....:....:|.::  |:      ||.|...
Zfish    68 IAILLYLAGKHSTPDHWYPADLQKRAQVDEFLSWQHTNIRSHGSKVFW--FKGVLPAVTGAPVPK 130

  Fly   125 EDLKRIETAFG--------FLDTFLEGQEYVAGDQLTVADI-AILSTVSTFEVSEFDFSKYSNVS 180
            |   ::::|..        |.|.||:.:.::.||::::||| ||:..:.........|.....:|
Zfish   131 E---KMDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADIVAIVEMMQPVATGVDVFEGRPALS 192

  Fly   181 RWYDNAKKVTPG---WDENWEGLMAMKAL 206
            .|.|..||.. |   :||..:.:|.:::|
Zfish   193 AWRDRVKKEV-GVELFDEAHKVIMNVESL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/133 (24%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 54/200 (27%)
GST_N_Theta 3..78 CDD:239348 24/74 (32%)
GST_C_Theta 91..217 CDD:198292 32/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.