DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and gdap1l1

DIOPT Version :10

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_687373.2 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:85 Identity:17/85 - (20%)
Similarity:36/85 - (42%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68
            |:.......:.|.:|....||...::.::....||.:|.|::||....:|..:.....:.:...|
Zfish    51 YHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSDYNQI 115

  Fly    69 AVYLVEKYGKDD--YLLPND 86
            ..|:...:..|.  .|:|::
Zfish   116 IDYIETNFVGDTVAQLIPDE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 14/69 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287
gdap1l1XP_687373.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.