DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:186 Identity:55/186 - (29%)
Similarity:88/186 - (47%) Gaps:24/186 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNK-KLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWE 64
            :|....|    ||:|.:.|||..:..|. ||.....||.|..||.|::..|.:|.|.|..|::.|
 Frog    10 LDLLSQP----CRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGNFTMAE 70

  Fly    65 SRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYY-----PLFRTGKPGSD 124
            |.|:.:||..||...::..|:|.:|||.:::.|.:.........:|.::     |.. .||....
 Frog    71 STAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTI-LGKEVPS 134

  Fly   125 EDLKRIETAF-----GFLDTFLEGQEYVAGDQLTVADI--------AILSTVSTFE 167
            |.:..:...|     .|.:.||..:.::|||:::|||:        .|.|.|:.||
 Frog   135 EKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 27/73 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/98 (24%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 27/75 (36%)
GST_C_Theta 95..221 CDD:198292 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.