Sequence 1: | NP_524912.1 | Gene: | GstD2 / 48335 | FlyBaseID: | FBgn0010038 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007386.1 | Gene: | clic5a / 492513 | ZFINID: | ZDB-GENE-041114-84 | Length: | 246 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 48/205 - (23%) |
---|---|---|---|
Similarity: | 82/205 - (40%) | Gaps: | 41/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 GGC---RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVY 71
Fly 72 LVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDL-KRIETAFG 135
Fly 136 FLDTFLE------------GQE------YVAGDQLTVADIAILSTVSTFEV-----SEFDF-SKY 176
Fly 177 SNVSRWYDNA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD2 | NP_524912.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 15/66 (23%) |
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 30/124 (24%) | ||
clic5a | NP_001007386.1 | GST_N_CLIC | 8..97 | CDD:239359 | 18/79 (23%) |
O-ClC | 10..244 | CDD:129941 | 48/205 (23%) | ||
GST_C_CLIC5 | 104..244 | CDD:198330 | 28/118 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589646 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |