DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GstD7

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:217 Identity:145/217 - (66%)
Similarity:169/217 - (77%) Gaps:4/217 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            :|.|..|.....|.:.|||||||||||.||:|||||:|||||||::||||||||||||||.||||
  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68

  Fly    66 RAIAVYLVEKYGK-DDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKR 129
            ||||||||||||| |..|.||||:|||:|||||||||||||::..||::.:|||||.|..|.|.:
  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDK 133

  Fly   130 IETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWD 194
            :.:|||||:||||||::|||.|||||||.||:||||.|...||.||:.||.||..||.||||||:
  Fly   134 VNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGWE 198

  Fly   195 ENWEGL-MAMKALFDARKLAAK 215
            :|.|.| ...|.|.|.:  |||
  Fly   199 QNLESLQQGKKFLQDLQ--AAK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 54/72 (75%)
GST_C_Delta_Epsilon 88..204 CDD:198287 73/116 (63%)
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 54/72 (75%)
GstA 6..188 CDD:223698 127/181 (70%)
GST_C_Delta_Epsilon 92..206 CDD:198287 73/113 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468497
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.