DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GstD11

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:212 Identity:91/212 - (42%)
Similarity:130/212 - (61%) Gaps:2/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68
            ||:|....||:::::||.|.::...|::|.:|||||||:||.:||||.:||:.|.|..:||||||
  Fly    28 YYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAI 92

  Fly    69 AVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIETA 133
            ..|||..|||.|.|.|.|.:.||:::|||.||:||||.....||:|....|.|..:....::..|
  Fly    93 LSYLVA
AYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRAKLAEA 157

  Fly   134 FGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDENWE 198
            .|:|:|.|||:::.|.|..|:||:.:|.|||..|..||:...|.::.:|.|..|.....:|  :|
  Fly   158 VGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFELRPYKHIRQWLDRCKDHMAPFD--YE 220

  Fly   199 GLMAMKALFDARKLAAK 215
            .|.|.||...|....||
  Fly   221 ELNANKANMLADMFKAK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 35/69 (51%)
GST_C_Delta_Epsilon 88..204 CDD:198287 43/115 (37%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 35/69 (51%)
GST_C_Delta_Epsilon 112..231 CDD:198287 45/120 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.