DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GstO1

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:75/207 - (36%) Gaps:63/207 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KPEFVKLNPQHT-IPTL---VDNGFSIW-ESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYF 99
            |||:..|....| :|.|   .:.|..:. ||..|..||.||| .:..|.|.|..|:|  .:::  
  Fly    57 KPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKY-PEVPLYPKDLLKKA--QEKI-- 116

  Fly   100 DMGTLYESFAK----YYYPLFR------------TGKPGSDEDLKRIETAF------GFLDTFL- 141
                |.|.|.:    :||.|..            .|....:|:|||..|.|      |.||..: 
  Fly   117 ----LIERFGQFINAFYYLLLHDNPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMW 177

  Fly   142 ------EGQEYVAGDQLTVA-----------DIAILS-TVSTFEVSEFDFSKYSNVSR------- 181
                  :..:|....:..::           |:.|.. .|..|.:.....:||.|..|       
  Fly   178 PWCERFDSLKYTFEQKFELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSGQADYN 242

  Fly   182 -WYDNAKKVTPG 192
             .|:.||:|..|
  Fly   243 MLYNEAKRVKLG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 13/38 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/154 (21%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 12/37 (32%)
GstA 22..216 CDD:223698 40/167 (24%)
GST_C_Omega 109..234 CDD:198293 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.