DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GstE8

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:189 Identity:72/189 - (38%)
Similarity:114/189 - (60%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77
            |...:...|||:......:||:..|.|.|||::.|||||:|||.|:|..||:|.||:.|||.|||
  Fly    16 RAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLVSKYG 80

  Fly    78 KDDYLLPNDPKKRAVINQRLYFDMGTLY----ESFAKYYYPLFRTGKPG-SDEDLKRIETAFGFL 137
            :.|.|.|.|..:|||::|||:|:.|.::    ....|   |||.||:.. ..|....:...:.|:
  Fly    81 QSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITK---PLFATGQTTIPKERYDAVIEIYDFV 142

  Fly   138 DTFLEGQEYVAGDQLTVADIAILSTVSTFEV-SEFDFSKYSNVSRWYDNAKKVTPGWDE 195
            :|||.|.:::||||||:||.:::::::...| ...|..||:|::.|....::: |.::|
  Fly   143 ETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEEL-PYYEE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 28/60 (47%)
GST_C_Delta_Epsilon 88..204 CDD:198287 36/114 (32%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 70/183 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/60 (47%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/114 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460250
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.