DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GstE6

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:201 Identity:76/201 - (37%)
Similarity:119/201 - (59%) Gaps:9/201 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77
            |.|.:...||.|......::.:...||.||:::.|||||:|||.|:|..||:|.||..|||.||.
  Fly    16 RAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYA 80

  Fly    78 KDDYLLPNDPKKRAVINQRLYFDMGTLY----ESFAKYYYPLFRTGKPGSDEDLKRIETAFGFLD 138
            ..|.|.|.||.||||::|||:|:.|.::    .|.:|..  ||:.......|....|...:.|::
  Fly    81 DSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSV--LFQGQTKVPKERYDAIIEIYDFVE 143

  Fly   139 TFLEGQEYVAGDQLTVADIAILSTVSTFEV-SEFDFSKYSNVSRWYDNAKKVTPGWDE-NWEGLM 201
            |||:||:|:||:|||:||.:::|:|::.|. ...|.:||..:..|....::: |.::| |.:|:.
  Fly   144 TFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQL-PYYEEANGKGVR 207

  Fly   202 AMKALF 207
            .:.|:|
  Fly   208 QLVAIF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 26/60 (43%)
GST_C_Delta_Epsilon 88..204 CDD:198287 40/121 (33%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 70/182 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/60 (43%)
GST_C_Delta_Epsilon 91..209 CDD:198287 40/120 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460259
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.