DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GstE10

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:229 Identity:82/229 - (35%)
Similarity:119/229 - (51%) Gaps:31/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77
            |.|::..:||.|:.....|:...|:.|||:.::.|||||:|.|.|....||:|.||..|||.||.
  Fly    16 RAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHAIIGYLVNKYA 80

  Fly    78 KDDYLLPNDPKKRAVINQRLYFDMGTLYES-FAKYYYPLFRTGKPGSDED-LKRIETAFGFLDTF 140
            :.|.|.|.||.||||::|||:|:.|.|:.. |.:....||:.......:| |..::.|:..|:.|
  Fly    81 QSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRLAELKDAYALLEQF 145

  Fly   141 LEGQEYVAGDQLTVADIAILSTVSTFEVS--EFDFSKYSNVSRWY-----------DNAK----- 187
            |....||||.|||:||.:|::||||..:|  ..|.:||..:|.|.           ||.:     
  Fly   146 LAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFYEEDNLRGARLL 210

  Fly   188 ------KVTPGWDENWEGLMAMKALFDARKLAAK 215
                  |:...:|:.|:     ||..|.:..|.|
  Fly   211 ADKIRSKLPKQFDKLWQ-----KAFEDIKSGAGK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 25/60 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 44/141 (31%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 72/180 (40%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/60 (42%)
GST_C_Delta_Epsilon 91..211 CDD:198287 41/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460249
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.