Sequence 1: | NP_524912.1 | Gene: | GstD2 / 48335 | FlyBaseID: | FBgn0010038 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997847.1 | Gene: | clic1 / 324481 | ZFINID: | ZDB-GENE-030131-3202 | Length: | 241 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 42/206 - (20%) |
---|---|---|---|
Similarity: | 79/206 - (38%) | Gaps: | 43/206 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 GGC---RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVK-LNPQHTIPTLVDNGFSIWESRAIAV 70
Fly 71 YLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDL-KRIETAF 134
Fly 135 GFLDTFLEG------------------QEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYS---- 177
Fly 178 --NVSRWYDNA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD2 | NP_524912.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 17/67 (25%) |
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 23/124 (19%) | ||
clic1 | NP_997847.1 | GST_N_CLIC | 3..93 | CDD:239359 | 19/80 (24%) |
O-ClC | 6..241 | CDD:129941 | 42/206 (20%) | ||
GST_C_CLIC1 | 100..238 | CDD:198333 | 22/118 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589634 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |