DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and Clic

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:99 Identity:24/99 - (24%)
Similarity:46/99 - (46%) Gaps:18/99 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHT-IPTLVDNGFSIWE 64
            ||.|          ::...|.:.|:     :.|::.::..|:| :.|.:.| .|.|:|||.:|.|
  Fly    48 MDLY----------LLAELKTISLK-----VTTVDMQKPPPDF-RTNFEATHPPILIDNGLAILE 96

  Fly    65 SRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLY 98
            :..|..::::.......|...| |:.|.:.:.||
  Fly    97 NEKIERHIMKNIPGGYNLFVQD-KEVATLIENLY 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 18/73 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 4/11 (36%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 18/79 (23%)
O-ClC 21..231 CDD:129941 24/99 (24%)
GST_C_CLIC 118..232 CDD:198307 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.