DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:245 Identity:43/245 - (17%)
Similarity:81/245 - (33%) Gaps:83/245 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLV--DNGFSIWESRAIAVYLVEKYG 77
            |.:|....||...::.::..:.|..:|.|::||....:|.::  ||..|.::.   .:..||:..
  Rat    64 VRLVIAEKGLSCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQ---IIDYVERTF 125

  Fly    78 KDDY---LLP--NDPKKRAVINQRLYFDM--------G-------TLYESFAKYYYPLFRTGKPG 122
            ..::   |:|  ..|:...|:..|...|.        |       |......||.....|.....
  Rat   126 TGEHVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLAN 190

  Fly   123 SDEDLKRIE------------------------TAFGFLDTFL---------------------E 142
            :..||.:::                        ...|:|...|                     |
  Rat   191 ATTDLMKLDHEEPQLSEPYLSKQKKLMAKILEHDDVGYLKKILGELAMVLDQIEAELEKRKLENE 255

  Fly   143 GQE---YVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSR--WYDNAK 187
            ||.   ::.|...|:||:.:.:|:...        |:..:|:  |.|.::
  Rat   256 GQTCELWLCGCAFTLADVLLGATLHRL--------KFLGLSKKYWEDGSR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 13/60 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/165 (15%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 13/60 (22%)
GST_C_family 203..313 CDD:413470 15/103 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.