DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and Gsto2

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:155 Identity:34/155 - (21%)
Similarity:68/155 - (43%) Gaps:26/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMVAKALGLE-LNKKLLNTMEGEQLKPE-FVKLNPQHTIPTLVDNGFS-IWESRAIAVYLVEKY 76
            :::.||::..| :|..|.|       ||: :...:|...:|.|.::... |:||.....||.:.:
  Rat    40 LVLKAKSIRHEIININLKN-------KPDWYYTKHPFGQVPVLENSQCQLIYESVIACEYLDDVF 97

  Fly    77 -GKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSD------EDLKRIETAF 134
             |:.  |.|.||.:||  .|::..::.......:|......|.|:..:|      ::|..:|...
  Rat    98 PGRK--LFPYDPYERA--RQKMLLELFCKVPQLSKECLVALRCGRDCTDLKVALRQELCNLEEIL 158

  Fly   135 GFLDTFLEGQEYVAGDQLTVADIAI 159
            .:.:|     .:..||.:::.|..:
  Rat   159 EYQNT-----TFFGGDSISMIDYLV 178

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 16/61 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 13/78 (17%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 15/60 (25%)