DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTT1

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens


Alignment Length:171 Identity:48/171 - (28%)
Similarity:86/171 - (50%) Gaps:15/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            :|....|    ||.|.:.||...:....::::.::|:.|...|.::||...:|.|.|..|::.||
Human     7 LDLLSQP----CRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67

  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYES-----FAKYYYPLFRTGKPGSDE 125
            .||.:||..||...||..|.|.:.||.:::.|.:...||..|     :.|..:|:| .|:|.|.:
Human    68 VAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVF-LGEPVSPQ 131

  Fly   126 ----DLKRIETAFGFL-DTFLEGQEYVAGDQLTVADIAILS 161
                .|..::.....| |.||:.:.::.|..:::||:..::
Human   132 TLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAIT 172

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 20/84 (24%)
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 22/74 (30%)