DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and Clic2

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:221 Identity:52/221 - (23%)
Similarity:91/221 - (41%) Gaps:50/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYMPGGGG--------CRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVK-LNPQHTIPTLV 56
            ::.:...|..|        |:.:.|:....|::.|...::|..    |||.:| |.|....|.|:
  Rat    14 IELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTIDTAR----KPEELKDLAPGTNPPFLI 74

  Fly    57 DNGFSIWESRAIAVYLVEKYGKDDYLLPN-DPKKRAVINQRLYFDMG-TLYESFAKYYYPLFRTG 119
            .|.....:...|..:|.:......|  |: .||.:.      .||:| .|:..|:.|   :..|.
  Rat    75 YNKELKTDFIKIEEFLEKTLAPPRY--PHLSPKYKE------SFDVGCNLFAKFSAY---IKNTQ 128

  Fly   120 KPGSDEDLKRIETAFGFLDTFL----------EGQE--------YVAGDQLTVADIAILSTVSTF 166
            |..:....|.:...|..||.:|          :..|        ::.|||||:||.::|..::..
  Rat   129 KEANKNFEKSLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLTLADCSLLPKLNII 193

  Fly   167 EVS-----EFDF-SKYSNVSRWYDNA 186
            :|:     :||. :::|.|.|:..||
  Rat   194 KVAAKKYRDFDIPAEFSGVWRYLHNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 18/81 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/124 (25%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 18/85 (21%)
GST_N_CLIC 9..99 CDD:239359 18/88 (20%)
O-ClC 12..245 CDD:129941 52/221 (24%)
GST_C_CLIC2 106..244 CDD:198331 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.