DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and gst-34

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_741060.2 Gene:gst-34 / 260015 WormBaseID:WBGene00001782 Length:218 Species:Caenorhabditis elegans


Alignment Length:137 Identity:38/137 - (27%)
Similarity:60/137 - (43%) Gaps:20/137 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYY 112
            |....|.|..:||.:.:|.||..||..|:|.......::....::::|     :....|||....
 Worm    56 PFGRFPVLSIDGFDLAQSTAIHRYLARKFGYAGKSPEDEAFADSIVDQ-----VKEYLESFRPLL 115

  Fly   113 YPLFRTGKPGSDEDLKRI---------ETAFGFLDTFLE--GQEYVAGDQLTVADIAILSTV-ST 165
            |.. ::|||  :|::|||         ...|..|...|:  ..||:.||.||.||:.:...: |.
 Worm   116 YAQ-KSGKP--EEEVKRIHDEVYIPVKNLLFKILTRILKESKSEYLVGDGLTWADLVVADHLYSL 177

  Fly   166 FEVSEFD 172
            ..:.|.|
 Worm   178 TNIKELD 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 10/25 (40%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/97 (27%)
gst-34NP_741060.2 GST_N_Sigma_like 4..82 CDD:239337 10/25 (40%)
PTZ00057 6..213 CDD:173353 38/137 (28%)
GST_C_Sigma_like 92..200 CDD:198301 26/101 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.