DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and Clic5

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:220 Identity:46/220 - (20%)
Similarity:82/220 - (37%) Gaps:50/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FYYMPGG------GGC---RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDN 58
            |.::..|      |.|   :.:.|:....|:..|   :.|::.::...:...|.|....|.|..|
Mouse   251 FLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFN---VTTVDLKRKPADLHNLAPGTHPPFLTFN 312

  Fly    59 GFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMG-TLYESFAKYYYPLFRTGKPG 122
            |....:...|..:|.|....:.|     ||..|  ..|.....| .::..|:.|    .:..|..
Mouse   313 GDVKTDVNKIEEFLEETLTPEKY-----PKLAA--KHRESNTAGIDIFSKFSAY----IKNTKQQ 366

  Fly   123 SDEDLKR-IETAFGFLDTFLEG------------------QEYVAGDQLTVADIAILSTVSTFEV 168
            ::..|:| :..|...||.:|..                  ::::.||:||:||..:|..:...::
Mouse   367 NNAALERGLTKALRKLDDYLNSPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKI 431

  Fly   169 SEFDFSKYSNVSRWYDNAKKVTPGW 193
            ..   .||.|    ||...::|..|
Mouse   432 VA---KKYRN----YDIPAEMTGLW 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 16/79 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/126 (21%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 46/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.