DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and Gstt1

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:211 Identity:50/211 - (23%)
Similarity:94/211 - (44%) Gaps:42/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            :|....|    ||.:.:.||...:......:...:||.|...|.::||...:|.::|.||::.||
Mouse     7 LDLLSQP----CRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCES 67

  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYES-----FAKYYYPLFRTGK---PG 122
            .||.:||..||...|:..|.|.:.||.:::.|.:....|..|     :.|..:|:| .|:   |.
Mouse    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVF-LGEQIPPE 131

  Fly   123 S--------DEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTV--------STFEVSEF 171
            :        |.:|:.:|      |.||:.::::.|..:::||:..::.:        ..||    
Mouse   132 TLAATLAELDVNLQVLE------DKFLQDKDFLVGPHISLADLVAITELMHPVGGGCPVFE---- 186

  Fly   172 DFSKYSNVSRWYDNAK 187
               .:..::.||...:
Mouse   187 ---GHPRLAAWYQRVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/124 (19%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 50/211 (24%)
GST_N_Theta 3..78 CDD:239348 22/74 (30%)