Sequence 1: | NP_524912.1 | Gene: | GstD2 / 48335 | FlyBaseID: | FBgn0010038 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034397.1 | Gene: | Gdap1 / 14545 | MGIID: | 1338002 | Length: | 358 | Species: | Mus musculus |
Alignment Length: | 259 | Identity: | 48/259 - (18%) |
---|---|---|---|
Similarity: | 81/259 - (31%) | Gaps: | 100/259 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 VIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKD 79
Fly 80 DYLLPNDPKKRAVINQRLYFDMGTLYESFAKYY---------------------------YPLFR 117
Fly 118 TGKPGS-----------------------------------DED----LKRI----ETAFGFLDT 139
Fly 140 FLE----------GQEYVAGDQLTVADIAILSTVST-----FEVSEFDFSKYSNVSRWYDNAKK 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD2 | NP_524912.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 18/58 (31%) |
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 28/186 (15%) | ||
Gdap1 | NP_034397.1 | GST_N_GDAP1 | 26..98 | CDD:239350 | 18/62 (29%) |
GST_C_GDAP1 | 179..289 | CDD:198336 | 19/107 (18%) | ||
Required for mitochondrial localization. /evidence=ECO:0000250 | 320..358 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844781 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |