DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and GSTO2

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:201 Identity:49/201 - (24%)
Similarity:83/201 - (41%) Gaps:25/201 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMVAKALGLE-LNKKLLNTMEGEQLKPE-FVKLNPQHTIPTLVDNGFS-IWESRAIAVYLVEKY 76
            :::.||.:..| :|..|.|       ||| :...:|...||.|..:... |:||.....||.:.|
Human    40 LVLKAKDIRHEVVNINLRN-------KPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAY 97

  Fly    77 -GKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLK-RIETAFGFLDT 139
             |:.  |.|.||.:||  .|::..::........|......|.|:..:  :|| .:...|..|:.
Human    98 PGRK--LFPYDPYERA--RQKMLLELFCKVPHLTKECLVALRCGRECT--NLKAALRQEFSNLEE 156

  Fly   140 FLEGQE--YVAGDQLTVADIAILSTVSTFEV-SEFDFSKYSNVSRWYDNAKKVTPGWDENWEGLM 201
            .||.|.  :..|..:::.|..:.......:| ...|...::...|.:.:|.|    ||.....|:
Human   157 ILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMK----WDPTVCALL 217

  Fly   202 AMKALF 207
            ..|::|
Human   218 MDKSIF 223

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 18/61 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/119 (19%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 17/60 (28%)