Sequence 1: | NP_524912.1 | Gene: | GstD2 / 48335 | FlyBaseID: | FBgn0010038 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_254279.1 | Gene: | Clic1 / 114584 | MGIID: | 2148924 | Length: | 241 | Species: | Mus musculus |
Alignment Length: | 209 | Identity: | 42/209 - (20%) |
---|---|---|---|
Similarity: | 78/209 - (37%) | Gaps: | 49/209 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 GGC---RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVY 71
Fly 72 LVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDL-KRIETAFG 135
Fly 136 FLDTFL---------------EG---QEYVAGDQLTVADIAILSTVST----------FEVSEFD 172
Fly 173 FSKYSNVSRWYDNA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD2 | NP_524912.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 14/66 (21%) |
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 26/128 (20%) | ||
Clic1 | NP_254279.1 | Required for insertion into the membrane. /evidence=ECO:0000250 | 2..90 | 15/76 (20%) | |
O-ClC | 6..241 | CDD:129941 | 42/209 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844761 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |