DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and Clic1

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_254279.1 Gene:Clic1 / 114584 MGIID:2148924 Length:241 Species:Mus musculus


Alignment Length:209 Identity:42/209 - (20%)
Similarity:78/209 - (37%) Gaps:49/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GGC---RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVY 71
            |.|   :.:.||....|:..|   :.|::.::......||.|...:|.|:.......::..|..:
Mouse    22 GNCPFSQRLFMVLWLKGVTFN---VTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEF 83

  Fly    72 LVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDL-KRIETAFG 135
            |      :..|.|....|.|.:|.........::..|:.|    .:...|..:::| |.:..|..
Mouse    84 L------EAMLCPPRYPKLAALNPESNTSGLDIFAKFSAY----IKNSNPALNDNLEKGLLKALK 138

  Fly   136 FLDTFL---------------EG---QEYVAGDQLTVADIAILSTVST----------FEVSEFD 172
            .||.:|               ||   ::::.|::||:||..:|..:..          |.:.|  
Mouse   139 VLDNYLTSPLPEEVDETSAEDEGISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPE-- 201

  Fly   173 FSKYSNVSRWYDNA 186
              .:..|.|:..||
Mouse   202 --AFRGVHRYLSNA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 14/66 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/128 (20%)
Clic1NP_254279.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 15/76 (20%)
O-ClC 6..241 CDD:129941 42/209 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.