DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and vars1

DIOPT Version :10

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001298275.1 Gene:vars1 / 114427 ZFINID:ZDB-GENE-010601-1 Length:1271 Species:Danio rerio


Alignment Length:108 Identity:27/108 - (25%)
Similarity:50/108 - (46%) Gaps:10/108 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIETA-----FGFLDTFLEGQ 144
            :|.|:.:.:.|.|.|....|........:||.  |..|.|:.|::...|     ...||..|..:
Zfish    76 SDKKQESQVWQWLSFAENELTPVACAVAFPLL--GIMGVDKKLQQSSRAELLRVLKALDGTLALR 138

  Fly   145 EYVAGDQLTVADIAI-LSTVSTFE--VSEFDFSKYSNVSRWYD 184
            .::.|:.:|:||.|: ::.:..|:  :...|.....||:||::
Zfish   139 TFLVGESVTLADAAVAMAALLPFKYALEPADRKSLVNVTRWFN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 26/105 (25%)
vars1NP_001298275.1 GST_C_ValRS_N 80..202 CDD:198327 25/104 (24%)
PTZ00419 291..1270 CDD:240411
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.