DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD2 and eef1e1

DIOPT Version :9

Sequence 1:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001107137.1 Gene:eef1e1 / 100038230 XenbaseID:XB-GENE-493638 Length:174 Species:Xenopus tropicalis


Alignment Length:207 Identity:50/207 - (24%)
Similarity:88/207 - (42%) Gaps:59/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGLELNK-----------KLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESR 66
            :.::.:.|.|||...|           .:|.|.:|                |:||  |.|     
 Frog     4 KELVALEKCLGLNSGKYSSRAQGAGKIPVLQTNKG----------------PSLV--GLS----- 45

  Fly    67 AIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIE 131
            .||.:|| |..|.:.||.:..:::|::.|.|              .|.:....:..|.||::.: 
 Frog    46 TIASHLV-KEAKKEELLGSTAEEKAIVQQWL--------------EYRISYIDRASSKEDIRNV- 94

  Fly   132 TAFGFLDTFLEGQEYVAGDQLTVADIAIL----STVSTFEVSEFDFSKYSNVSRWYDNAKKVTPG 192
              ...|:.:|:.:.:|||:.:|:|||.|.    ..::...|.|.:  .|.|||||:.:.:.. ||
 Frog    95 --LNDLNHYLKDKVFVAGNTVTLADILIYYGLHPVITGLSVQEKE--TYINVSRWFSHIQNY-PG 154

  Fly   193 WDENWEGLMAMK 204
            ..::...|:.:|
 Frog   155 IRQHLPSLVFIK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 16/71 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/119 (24%)
eef1e1NP_001107137.1 GST_C_AIMP3 65..165 CDD:198338 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.