DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttk and lolal

DIOPT Version :9

Sequence 1:NP_001189329.1 Gene:ttk / 48317 FlyBaseID:FBgn0003870 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:118 Identity:66/118 - (55%)
Similarity:89/118 - (75%) Gaps:0/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSH 65
            |..:.|:|.|:||:.|:|:::.|..|...::|||||||.|||..||||||||||||||..|...:
  Fly     1 MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEEN 65

  Fly    66 PEKHPIVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTE 118
            |.||||:|||||.|..::::|:|||.|||:|.||:|.|||:.|:.|::|||.|
  Fly    66 PSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttkNP_001189329.1 BTB 23..119 CDD:279045 58/96 (60%)
BTB 34..119 CDD:197585 54/85 (64%)
C2H2 Zn finger 612..638 CDD:275370
zf-C2H2_4 646..669 CDD:290605
C2H2 Zn finger 648..669 CDD:275370
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 52/82 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9675
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.