DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttk and CG15812

DIOPT Version :9

Sequence 1:NP_001189329.1 Gene:ttk / 48317 FlyBaseID:FBgn0003870 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster


Alignment Length:515 Identity:103/515 - (20%)
Similarity:182/515 - (35%) Gaps:136/515 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRWNNHQSNLLSVFDQLLHAETFTDVTLAV-EGQHLKAHKMVLSACSPYFNTLFVSHPE-KHPIV 72
            |:|..|.|.::.:...|.:.....:|.||. :|..::||..|||.||.....|.|..|. :...:
  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68

  Fly    73 ILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIK----------------------- 114
            :|.|:....::.:|.|:|.||.|:....|..||.....|.||                       
  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFECNPSASPPSVDVENHSL 133

  Fly   115 ---------GL----TEVNDDKPS-------PAAAAAGAGATGSESTATTPQLQRIQP----YLV 155
                     ||    .|:.||:..       ||...||:....|.|:.:...:...:|    |.:
  Fly   134 AVESAKSITGLQIAEAELLDDEEEPHPMVSVPATTLAGSQHQPSHSSRSLEYIDVYEPPKITYSI 198

  Fly   156 PQRNRSQAGGLLASAANAGNTPTLPVQPSLLSSALMPKRKRGRPRKLSGSSNGTGN---DYDDFD 217
            ...:.|.:|.......|.| |.|:....|.||             |:.....||..   |..|.|
  Fly   199 EHMDGSSSGNQFILTENTG-TFTITQSASSLS-------------KIEADETGTSGAEVDLGDDD 249

  Fly   218 RENMMNDSSDLGNGKMCNESYSGNDD------GSDDNQPNAGHTDDLNESRDSLPSK------RS 270
            .:..:.:.|:....:|.:|.::..|.      |::.:..:..|...::|..|..|.|      |.
  Fly   250 VDADLAEDSEEHESQMIDEEFAQADPLMELEAGTEMDDDDDVHDQLVDEEIDDKPRKLGGGKTRI 314

  Fly   271 KNSKDHRVVSHHEDNSTSVTPTK----------ATPELSQRLFGSSSTTISATAPGGSSTGPSET 325
            :.....:.|....|    ..||:          ...:::..|..::...|            .|.
  Fly   315 RRPISAKAVKRLSD----CKPTRIQQFAALKREVKDDINDALDLAADAVI------------IEG 363

  Fly   326 ISLLEISDERESAPVHLPTILGLKIRAINTTTPAQQGSPQTPTKSKPKIRQA-TGSNNSNSLLKQ 389
            :||.:.:|..:.:    .|:|..::|    |.||...:    .:.:|.:::| ....|.:|    
  Fly   364 LSLQKAADRFDIS----KTVLWRRVR----TNPAYMRN----NRERPSLQEAYERLKNGHS---- 412

  Fly   390 QLRGGAKDPEVPPAT------------RITGAVTPNAALNAEEQSKEMPKKNQDEVNACI 437
             |:..:.:.::|.:|            |:...|:.....|..:.  |:..|....|:||:
  Fly   413 -LKSISSELQIPMSTLHRHKVRLSAQGRLPNFVSCRKRDNTPKD--ELRDKLAKAVHACL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttkNP_001189329.1 BTB 23..119 CDD:279045 31/133 (23%)
BTB 34..119 CDD:197585 30/122 (25%)
C2H2 Zn finger 612..638 CDD:275370
zf-C2H2_4 646..669 CDD:290605
C2H2 Zn finger 648..669 CDD:275370
CG15812NP_523897.2 BTB 20..113 CDD:279045 29/92 (32%)
BTB 35..118 CDD:197585 25/82 (30%)
HTH_psq 348..392 CDD:283007 12/63 (19%)
HTH_psq 458..501 CDD:283007 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.