DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Tmprss5

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:277 Identity:99/277 - (35%)
Similarity:130/277 - (46%) Gaps:48/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGTVPEGLLPQ--------------------LDGRIVGGSATTISSFPWQISLQRSGSHSCGGSI 60
            ||.|.|...|.                    |..|||||.|.....:|||.|:.....|:||.|:
Mouse   183 GGLVEESWKPSANCPSGRIVSLKCSECGARPLASRIVGGQAVASGRWPWQASVMLGSRHTCGASV 247

  Fly    61 YSANIIVTAAHCLQSVSASVLQ--------VRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDI 117
            .:.:.:||||||:.|...|.|.        |..|:.....|.:|.|:..   |..|:|.....|:
Mouse   248 LAPHWVVTAAHCMYSFRLSRLSSWRVHAGLVSHGAVRQHQGTMVEKIIP---HPLYSAQNHDYDV 309

  Fly   118 AVIRLSSSLSFSSSIKAISLATYNPAN------GASAAVSGWGTQSSGSSSIPSQLQYVNVNIVS 176
            |:::|.:.::||.::.|:.|    ||.      |:...|||||......:.....||...|.::|
Mouse   310 ALLQLRTPINFSDTVGAVCL----PAKEQHFPWGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLS 370

  Fly   177 QSQCASSTYGYGSQIRNTMICAA-ASGK-DACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNY 235
            ...|.||.. |...:.:.|:||. ..|: ||||||||||||  ||..  ||||||||.|||..|.
Mouse   371 TYLCNSSCM-YSGALTHRMLCAGYLDGRADACQGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNR 434

  Fly   236 PGVYADVAVLRSWVVST 252
            |||||.||....|:..|
Mouse   435 PGVYAKVAEFLDWIHDT 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 91/238 (38%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 5/29 (17%)
Tryp_SPc 217..448 CDD:214473 91/238 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.